PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr7P11580_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family bHLH
Protein Properties Length: 91aa    MW: 10273.7 Da    PI: 8.5173
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr7P11580_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH21.44.5e-0718571554
                           HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
                    HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                           +i + +++L++llP++ + +  + s a  L++++ YIksL
  GSMUA_Achr7P11580_001 18 EISELISKLQSLLPESRRRSMSRASAAKLLKETCSYIKSL 57
                           69999**********76788888****************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088810.245357IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474591.44E-81780IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000102.1E-41857IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.107.7E-91873IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 91 aa     Download sequence    Send to blast
MPVEMSSRRS SSRISDEEIS ELISKLQSLL PESRRRSMSR ASAAKLLKET CSYIKSLHRE  60
VDDLSDRLSD LMSTMDSGSP QAEIIRSILR S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009409145.14e-55PREDICTED: transcription factor ILI5-like
SwissprotA2X9L81e-38ILI5_ORYSI; Transcription factor ILI5
SwissprotQ6YUX01e-38ILI5_ORYSJ; Transcription factor ILI5
TrEMBLM0TGP64e-55M0TGP6_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P11580_0011e-54(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26753378
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.16e-10bHLH family protein